Om oss
Hangzhou Go Top Peptide Biotech Co., Ltd. grundades 2014, är ett nationellt högteknologiskt företag specialiserat på FoU och produktion av peptider och relaterade derivat. Det är också en styrande enhet för Polypeptide Branch of China Biochemical and Pharmaceutical Industry Association. För närvarande har företaget ett peptidforsknings- och utvecklingscenter i Hangzhou, som täcker en yta på mer än 4 000 kvadratmeter, och två kommersiella peptidfabriker i Shangyu och Anji, Zhejiang, med flera kompletta peptidproduktionslinjer, flera uppsättningar storskalig utrustning för peptidsyntes, importerad HPLC-analys- och beredningsutrustning, och ren utrustad med en GMP-standard. Företaget har godkänt ISO9001:2015 kvalitetsledningssystemcertifiering.
Våra produkter
-
30505-63-6, BPP 5a, peptide synthesis services
-
1135686-31-5, Cathepsin S substrate, custom peptide synthesis service
-
Brevinin-1, direct supply from the source, Hangzhou Peptide Company
-
150671-04-8,Ceratotoxin A, Hangzhou Polypeptide Company
-
51004-61-6, AF-2, nematod, anpassad peptidsyntes
-
NA-931, Bioglutid
-
103429-31-8, CTOP, peptidsyntes
-
100930-02-7, Proctolin, anpassad peptidsyntes
-
Anorexigen peptid, 69275-10-1, polypeptidmaterial
-
374898-11-0,[Phe1,Ser2]-TRAP-6, Peptidsyntes
Våra nyheter
-
Synthesis Method and Technical Key Points of RGDfK Cyclic Peptide
General description of synthetic route RGDfK cyclic peptide is a specific ligand for integrin αvβ3 r...
-
The Role of Heterocyclic Chemistry in Organic Chemistry
Heterocyclic compounds constitute the largest and most diverse family of organic compounds. More tha...
-
Förberedelse av SNAP-8
Översikt SNAP-8 beredningsmetoder SNAP-8, nämligen acetyloktapeptid -3, är en polypeptid med N...
-
Ny generation multi-target co-agonist peptider
Även om traditionella GLP-1-receptoragonister med ett mål effektivt kan förbättra leversteatos...
