Om oss
Hangzhou Go Top Peptide Biotech Co., Ltd. grundades 2014, är ett nationellt högteknologiskt företag specialiserat på FoU och produktion av peptider och relaterade derivat. Det är också en styrande enhet för Polypeptide Branch of China Biochemical and Pharmaceutical Industry Association. För närvarande har företaget ett peptidforsknings- och utvecklingscenter i Hangzhou, som täcker en yta på mer än 4 000 kvadratmeter, och två kommersiella peptidfabriker i Shangyu och Anji, Zhejiang, med flera kompletta peptidproduktionslinjer, flera uppsättningar storskalig utrustning för peptidsyntes, importerad HPLC-analys- och beredningsutrustning, och ren utrustad med en GMP-standard. Företaget har godkänt ISO9001:2015 kvalitetsledningssystemcertifiering.
Våra produkter
-
1948-29-4,H-Glu(Gly-OH)-OH, peptide synthesis
-
13589-04-3,H-Met-Tyr-OH, Gutuo peptide
-
23576-42-3, Phe-Gly-Gly, peptide synthesis
-
IW-2143,13589-06-5, Gutuo peptide
-
Hemorfin-7, peptidsyntes, go top peptid
-
F-M-R-F, 74012-06-9, Go Top-peptid
-
Z-Pro-D-Leu,61596-47-2,Go Top-peptid
-
Valorphin,144313-54-2, peptidanpassning
-
Dansyl-Y-V-G,113527-49-4, Peptidsyntes
-
G-P-R, Go Top-peptid, peptidanpassning
Våra nyheter
-
(I) on the Related Technology and Prospect of Cyclic Peptide Synthesis
In recent decades, as more and more natural cyclic peptides with various biological activities have...
-
2026 CPHI Milan Exhibition | Gutuo has been deeply cultivating polypeptide field
6-8 October 2026, annual event for the global pharmaceutical industry-- CPHI Worldwide Milan Exhibit...
-
En vätskefasmetod för acetyltetrapeptid -9
Översikt acetyltetrapeptid -9 är en syntetisk peptidsubstans som består av fyra aminosyrarester...
